PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0327s0070.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 578aa    MW: 64987.5 Da    PI: 5.8966
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0327s0070.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS422.43.8e-1292075761373
                    GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                             l++lL++cA+a+++++ +  ++l+++ +  +s +g+p+qRl ay+ e+L ar  +s++++y++l+++e +    ++ ++++++++e+
  SapurV1A.0327s0070.2.p 207 LKQLLIACAKALDENKVNDFDKLIEKARSVVSISGEPIQRLGAYLIEGLVARKESSGTNIYHTLRCKEPE---GKDLMSYMHILYEI 290
                             689******************************************************************9...99************ PP

                    GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeel 172
                             +P+lkf++++aN aI ea ++e+r+HiiDf i qG+QW++LlqaLasRp+g+p++RiTg+++p s+  + + le+++++++ f e++
  SapurV1A.0327s0070.2.p 291 CPYLKFGYMAANGAIAEACKNEDRIHIIDFHIAQGTQWMTLLQALASRPSGAPHVRITGIDDPLSKyaRGDGLEAVARQMTAFSEKF 377
                             **************************************************************9999999****************** PP

                    GRAS 173 gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfle 259
                             ++p+ef+  v     d++ e+++v+pgEalaVn+ l+lh+++desv+++++rd++L+++ksl+Pkvv+++eqe+++n+++Fl+rf+e
  SapurV1A.0327s0070.2.p 378 KIPIEFHG-VPVFAPDVTKEMFDVRPGEALAVNFPLELHHTPDESVDVNNPRDSLLRMIKSLNPKVVTLMEQESNTNTTPFLTRFVE 463
                             ********.6888999*********************************************************************** PP

                    GRAS 260 aleyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvks 346
                             +l+yy a+f+s+++ lpr+++eri+vE+++l+r+ivnv+aceg+er+erhe l+kW++r+++aGF++ pls++ ++ +++llr ++ 
  SapurV1A.0327s0070.2.p 464 TLNYYLAIFESIDVRLPRDQKERISVEQHCLARDIVNVIACEGKEREERHELLRKWKSRFTMAGFRQWPLSSYLNSVIRSLLRCYS- 549
                             **********************************************************************************9999. PP

                    GRAS 347 dgyrveeesgslvlgWkdrpLvsvSaW 373
                             + y++ e +g+++lgWkdr+L+s+SaW
  SapurV1A.0327s0070.2.p 550 EHYTLVEIDGAMLLGWKDRNLISASAW 576
                             66************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.677181558IPR005202Transcription factor GRAS
PfamPF035141.3E-126207576IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
MESHQYFGYG VTGAALSYPS SYPSVPSMPN RLFGSLKLDI GNSTSSPFSS QYDCDTYAAT  60
LSDSQDRHSS TENLSGESSS YFSGLNPSVD CQQESLQIFP GGTSLLQDES SSQNIKLALL  120
KLETTLMGPD EDEEVNRPYI SLGKTSRPQT SDQKPRVWSQ ERQDSHVIQT QTSFVSRQRQ  180
FGEGAHVEKR QKEMEEVPLR GIPSGDLKQL LIACAKALDE NKVNDFDKLI EKARSVVSIS  240
GEPIQRLGAY LIEGLVARKE SSGTNIYHTL RCKEPEGKDL MSYMHILYEI CPYLKFGYMA  300
ANGAIAEACK NEDRIHIIDF HIAQGTQWMT LLQALASRPS GAPHVRITGI DDPLSKYARG  360
DGLEAVARQM TAFSEKFKIP IEFHGVPVFA PDVTKEMFDV RPGEALAVNF PLELHHTPDE  420
SVDVNNPRDS LLRMIKSLNP KVVTLMEQES NTNTTPFLTR FVETLNYYLA IFESIDVRLP  480
RDQKERISVE QHCLARDIVN VIACEGKERE ERHELLRKWK SRFTMAGFRQ WPLSSYLNSV  540
IRSLLRCYSE HYTLVEIDGA MLLGWKDRNL ISASAWC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-612045761374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002317558.10.0hypothetical protein POPTR_0011s13460g
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLB9I0720.0B9I072_POPTR; Uncharacterized protein
STRINGPOPTR_0011s13460.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.11e-161scarecrow-like 5